126738-APC
FDPS (Farnesyl Pyrophosphate Synthase, FPP Synthase, FPS, Farnesyl Diphosphate Synthase, FPS, KIAA1293) (APC)
Größe
£927.00
- SKU:
- 126738-APC
- Anwendung:
- FLISA
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa320-419 from human FDPS (NP_001995.1) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3A6
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Weitere Details:
- The isoprene biosynthetic pathway supply the cell with cholesterol, ubiquinone, and various nonsterol metabolites. The farnesylpyrophosphate synthetase enzyme catalyzes the formation of geranyl and farnesylpyrophosphate from isopentenylpyrophosphate and dimethylallyl pyrophosphate. Analysis of FDPS activity and protein in rat liver, accompanied by immunofluorescence and immunoelectron microscopy studies, demonstrated that FDPS is predominantly localized in peroxisomes.1 Liver tissue from patients with the peroxisomal deficiency diseases Zellweger syndrome and neonatal adrenoleukodystrophy exhibit diminished activities of FDPS and subsequent isoprenoid synthesis. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKEAEKVARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice