FBXO8 (F-box Only Protein 8, F-box/SEC7 Protein FBS, FBS, FBX8, DC10, UNQ1877/PRO4320)

Größe

£685.00

SKU:: 126709
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-78 from human FBXO8 (NP_036312) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1C11
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: May promote guanine-nucleotide exchange on an ARF. Promotes the activation of ARF through replacement of GDP with GTP. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGQGLWRVVRNQQLQQEGYSEQGYLTREQSRRMAASNISNTNHRKQVQGGIDIYHLLKARKSKEQEGFINLEMLPPE* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.