126660-ML490

FBXL21 (F-box/LRR-repeat Protein 21, F-box and Leucine-rich repeat Protein 21, F-box and Leucine-rich Repeat Protein 3B, F-box/LRR-repeat Protein 3B, FBL21, FBL3, FBXL3B, FBXL3P) (MaxLight 490)

Größe

£914.00

SKU:: 126660-ML490
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa167-277 from human FBXL21 (NP_036291) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4A1
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
Weitere Details:: MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. Substrate-recognition component of some SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex involved in circadian pacemaker function. The SCF(FBXL21) complex acts by mediating ubiquitination and subsequent degradation of CRY1. Probable clock-controlled protein that plays a specific role in suprachiasmatic nucleus, SCN and pacemaker function. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VSKVVLGRVGLNCPRLIELVVCANDLQPLDNELICIAEHCTNLTALGLSKCEVSCSAFIRFVRLCERRLTQLSVMEEVLIPDEDYSLDEIHTEVSKYLGRVWFPDVMPLW* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Versandbedingungen:: Blue Ice