126660-HRP
FBXL21 (F-box/LRR-repeat Protein 21, F-box and Leucine-rich repeat Protein 21, F-box and Leucine-rich Repeat Protein 3B, F-box/LRR-repeat Protein 3B, FBL21, FBL3, FBXL3B, FBXL3P) (HRP)
Größe
£914.00
- SKU:
- 126660-HRP
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa167-277 from human FBXL21 (NP_036291) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4A1
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
- Weitere Details:
- Substrate-recognition component of some SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex involved in circadian pacemaker function. The SCF(FBXL21) complex acts by mediating ubiquitination and subsequent degradation of CRY1. Probable clock-controlled protein that plays a specific role in suprachiasmatic nucleus, SCN and pacemaker function. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VSKVVLGRVGLNCPRLIELVVCANDLQPLDNELICIAEHCTNLTALGLSKCEVSCSAFIRFVRLCERRLTQLSVMEEVLIPDEDYSLDEIHTEVSKYLGRVWFPDVMPLW* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice