FBXL17 (F-box/LRR-repeat Protein 17, F-box and Leucine-rich Repeat Protein 17, F-box Only Protein 13, FBL17, FBX13, FBXO13, DKFZp434C1715, DKFZP434C1715, MGC161422, MGC161424)

Größe

£685.00

SKU:: 126656
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa194-304 from human FBXL17 (NP_073735) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 6C12
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QNLKELYLVSCKITDYALIAIGRYSMTIETVDVGWCKEITDQGATLIAQSSKSLRYLGLMRCDKVNEVTVEQLVQQYPHITFSTVLQDCKRTLERAYQMGWTPNMSAASS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.