FABP5 (Fatty Acid-binding Protein, Epidermal, Epidermal-type Fatty Acid-binding Protein, E-FABP, Fatty Acid-binding Protein 5, Psoriasis-associated Fatty Acid-binding Protein Homolog, PA-FABP)

Größe

£760.00

SKU:: 126554
Anwendung:: WB
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Full length human FABP5, aa1-135 (NP_001435.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: FABPs have been reported to be involved in the uptake and metabolism of fatty acids, maintenance of cellular membrane fatty acids levels, intracellular trafficking, modulation of specific enzymes of lipid metabolic pathways, as well as in the modulation of cell growth and differentiation. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.