126526-BIOTIN

EYS (Protein Eyes Shut Homolog, Epidermal Growth Factor-like Protein 10, EGF-like Protein 10, Epidermal Growth Factor-like Protein 11, EGF-like Protein 11, Protein Spacemaker Homolog, C6orf178, C6orf179, C6orf180, EGFL10, EGFL11, SPAM, UNQ9424/PRO34591) (Biotin)

Größe

£914.00

SKU:: 126526-BIOTIN
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa309-407 from human EYS with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3F2
Format:: Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with Biotin.
Weitere Details:: Required to maintain the integrity of photoreceptor cells. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: HVVVIQNQTLIKAYINNSLILSEDIDPHKNFVALNYDGICYLGGFEYGRKVNIVTQEIFKTNFVGKIKDVVFFQEPKNIELIKLEGYNVYDGDEQNEVT Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.