EXOSC4 (RRP41, SKI6, Exosome Complex Component RRP41, Exosome Component 4, Ribosomal RNA-processing Protein 41, p12A, FLJ20591, RRP41A, Rrp41p, SKI6, Ski6p, HRrp41p)

Größe

£685.00

SKU:: 126512
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-101 from human EXOSC4 (NP_061910) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4F10
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Component of the exosome 3'->5' exoribonuclease complex, a complex that degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3'-untranslated regions. Required for the 3'-processing of the 7S pre-RNA to the mature 5.8S rRNA. Has a 3'-5' exonuclease activity. Plays a role in replication-dependent histone mRNA degradation. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAGLELLSDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHEIRGSRARALPDRALVNCQYSSATFSTGERKRRPHGDRKSCEMG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.