EVI1 (MDS1 and EVI1 Complex Locus Protein EVI1, Ecotropic Virus Integration Site 1 Protein Homolog, EVI-1, MECOM)

Größe

£685.00

SKU:: 126490
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa952-1050 from human EVI1 (NP_005232) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 6A9
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: EVI1 promotes cell proliferation by interacting with BRG1 and blocking the repression of BRG1 on E2F1 activity. EVI1 may be involved in megakaryocytic differentiation. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit is ~0.03ng/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: YKSGLSALDHIRHFTDSLKMRKMEDNQYSEAELSSFSTSHVPEELKQPLHRKSKSQAYAMMLSLSDKESLHSTSHSSSNVWHSMARAAAESSAIQSISH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.