ETV4 (ETS Translocation Variant 4, Polyomavirus Enhancer Activator 3 Homolog, Protein PEA3, Adenovirus E1A Enhancer-binding Protein, E1A-F, E1AF)

Größe

£685.00

SKU:: 126482
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-207 from human ETV4 (AAH07242) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3G9-1B9
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: ETV4 is a transcriptional activator that binds to the enhancer of the adenovirus E1A gene; the core-binding sequence is 5'[AC]GGA[AT]GT-3'. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit is ~0.1ng/ml as a capture antibody Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MYLHTEGFSGPSPGDGAMGYGYEKPLRPFPDDVCVVPEKFEGDIKQEGVGAFREGPPYQRRGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDESPAYLPELAGPAQPFGPKGGYSY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.