126478-PE
ETS1 (Protein C-ets-1, p54, EWSR2) (PE)
Größe
£934.00
- SKU:
- 126478-PE
- Anwendung:
- WB
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length human ETS1, aa1-441 (NP_005229.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
- Weitere Details:
- ETS1, a 441aa protein, is a member of DNA-binding ETS protein family. It is a multifunctional protein consisting of an N-terminal pointed domain, a central transactivation domain and 2 auto inhibitory domains flanked on both sides of conserved C-terminal Ets domain. It interacts with factors including PEBP2alphaA, p300/CBP and mediates transactivation of Osteopontin, Presenilin-1, Stromelysin and Collagenase. It is activated by Ras/MAPK signaling and its expression is up-regulated in resting T-cells. Its activity is modulated by various factors including AP-1, Sp-1, c-myb and MafB. Sp100 activates ETS1 in nuclear bodies. It interacts with EAP1/Daxx and causes repression of MMP1 and BCL2 transactivation. It interacts with STAT6 and modulates Socs-1 expression induced by IL-4. It interacts with GATA3 and positively regulates Tax-1 dependent IL-5 expression. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDADE Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice