ENTPD5 (Ectonucleoside Triphosphate Diphosphohydrolase 5, NTPDase 5, CD39 Antigen-like 4, ER-UDPase, Guanosine-diphosphatase ENTPD5, GDPase ENTPD5, Nucleoside Diphosphatase, Uridine-diphosphatase ENTPD5, UDPase ENTPD5, CD39L4, PCPH)

Größe

£685.00

SKU:: 126352
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa319-400 from human ENTPD5 (NP_001240) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4A5
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: CD39L4, also called ENTPD5 (ectonucleoside triphosphate diphosphohydrolase 5), ERUDPase and PCPH, is a secreted, 45-51kD class II member of the GDA1/CD39 NTPase family of molecules. It is expressed by multiple cell types, including neurons, cardiomyocytes, and hepatocytes. CD39L4 is a divalent cation dependent enzyme that preferentially hydrolyzes GDP and UDP. In the ER, this enzyme may remove UDP which interferes with proper protein folding and maturation. Extracellularly, CD39L4 may reduce available UDP ligand for P2Y receptors. Mature human CD39L4 is a 408aa glycoprotein (aa21-428). It contains four APR (apyrase conserved regions) (aa54-206) that participate in NTPase activity. CD39L4 has been reported to exist as both monomer and homodimer. Three potential splice variants are reported. One shows a seven aa substitution for aa401-428, a second contains a five aa substitution for aa401-428, and a third possesses a 22aa substitution for aa215-428. Over aa21-428, human CD39L4 shares 89% aa sequence identity with mouse CD39L4. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EEVQRGSFYAFSYYYDRAVDTDMIDYEKGGILKVEDFERKAREVCDNLENFTSGSPFLCMDLSYITALLKDGFGFADSTVLQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice