126352-ML490

ENTPD5 (Ectonucleoside Triphosphate Diphosphohydrolase 5, NTPDase 5, CD39 Antigen-like 4, ER-UDPase, Guanosine-diphosphatase ENTPD5, GDPase ENTPD5, Nucleoside Diphosphatase, Uridine-diphosphatase ENTPD5, UDPase ENTPD5, CD39L4, PCPH) (MaxLight 490)

Größe

£914.00

SKU:: 126352-ML490
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa319-400 from human ENTPD5 (NP_001240) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4A5
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
Weitere Details:: MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. CD39L4, also called ENTPD5 (ectonucleoside triphosphate diphosphohydrolase 5), ERUDPase and PCPH, is a secreted, 45-51kD class II member of the GDA1/CD39 NTPase family of molecules. It is expressed by multiple cell types, including neurons, cardiomyocytes, and hepatocytes. CD39L4 is a divalent cation dependent enzyme that preferentially hydrolyzes GDP and UDP. In the ER, this enzyme may remove UDP which interferes with proper protein folding and maturation. Extracellularly, CD39L4 may reduce available UDP ligand for P2Y receptors. Mature human CD39L4 is a 408aa glycoprotein (aa21-428). It contains four APR (apyrase conserved regions) (aa54-206) that participate in NTPase activity. CD39L4 has been reported to exist as both monomer and homodimer. Three potential splice variants are reported. One shows a seven aa substitution for aa401-428, a second contains a five aa substitution for aa401-428, and a third possesses a 22aa substitution for aa215-428. Over aa21-428, human CD39L4 shares 89% aa sequence identity with mouse CD39L4. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EEVQRGSFYAFSYYYDRAVDTDMIDYEKGGILKVEDFERKAREVCDNLENFTSGSPFLCMDLSYITALLKDGFGFADSTVLQ Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Versandbedingungen:: Blue Ice