126347-PE
ENTH (Clathrin Interactor 1, Epsin-4, Epsin-related Protein, EpsinR, Enthoprotin, Clathrin-interacting Protein Localized in the Trans-Golgi region, Clint, KIAA0171, EPNR, EPN4, CLINT1) (PE)
Größe
£914.00
- SKU:
- 126347-PE
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa161-261 from ENTH (NP_055481) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1E6
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
- Weitere Details:
- One of the main pathways by which membrane components and proteins are taken into a cell is through clathrin-mediated endocytosis. This pathway leads to the building and formation of clathrin-coated pits, also known as CCVs. Enthoprotin is a highly enriched protein localized on the CCVs, interacting with AP1 and Arf-binding protein 2, both clathrin adaptors. Through the binding of the clathrin heavy chain by its COOH-terminal domain, Enthoprotin induces clathrin production. Abnormalities in the gene encoding for Enthoprotin affect genetic susceptibility to Schizophrenia type I, a highly heritable psychosis. Enthoprotin is expressed throughout tissue types at intermediate to low levels. Applications: Suitable for use in FLISA, Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: GVSSDSVGGFRYSERYDPEPKSKWDEEWDKNKSAFPFSDKLGELSDKIGSTIDDTISKFRRKDREDSPERCSDSDEEKKARRGRSPKGEFKDEEETVTTKH Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice