ENO3 (Enolase 3, 2-phospho-D-glycerate Hydro-lyase, beta-Enolase, Muscle-specific Enolase, MSE, Skeletal Muscle Enolase)

Größe

£685.00

SKU:: 126334
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa228-277 from human ENO3 (NP_001967) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 5D1
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: ENO3, is one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in skeletal muscle cells in the adult. ENO3 play a role in converting phosphoglyceric acid to phosphenolpyruvic acid in the glycolytic pathway. Mutations in its gene can be associated with metabolic myopathies that may result from decreased stability of the enzyme. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 1.5-3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.