126308-BIOTIN
EMP3 (Epithelial Membrane Protein 3, YMP, EMP-3, Hematopoietic Neural Membrane Protein 1, HNMP-1, Protein YMP) (Biotin)
Größe
£934.00
- SKU:
- 126308-BIOTIN
- Anwendung:
- WB
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length human EMP3, aa1-163 (NP_001416.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- Epithelial membrane protein 3 (EMP3) is a multipass transmembrane protein in the peripheral myelin protein 22 family. It is expressed as a 20-25kD molecule depending on the degree of glycosylation. EMP3 interacts with the P2X7 purinergic receptor on monocytes. Its dysregulation is associated with glioma and neuroblastoma. Human EMP3 shares 93% aa sequence identity with mouse and rat EMP3. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQVLMVLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAIHAEEILEKHPRGGSFGYCFALAWVAFPLALVSGIIYIHLRKRE Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice