ELK3 (ETS Domain-containing Protein Elk-3, ETS-related Protein ERP, ETS-related Protein NET, Serum Response Factor Accessory Protein 2, SAP-2, SRF Accessory Protein 2, NET, SAP2)

Größe

£685.00

SKU:: 126284
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa101-200 from human ELK3 (NP_005221.2) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3A12
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: May be a negative regulator of transcription, but can activate transcription when coexpressed with Ras, Src or Mos. Forms a ternary complex with the serum response factor and the ETS and SRF motifs of the Fos serum response element. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SRESLLLQDSDCKASPEGREAHKHGLAALRSTSRNEYIHSGLYSSFTINSLQNPPDAFKAIKTEKLEEPPEDSPPVEEVRTVIRFVTNKTDKHVTRPVVS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.