ELF3 (E74-like Factor 3 (ets Domain Transcription Factor, Epithelial-specific), EPR-1, ERT, Epithelium-specific Ets Transcription Factor 1, ESE-1, Epithelial-restricted with Serine Box, ESX)

Größe

£685.00

SKU:: 126278
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa262-371 from human ELF3 (AAH03569) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1D8
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: ELF3 is a 41-43kD member of the ETS family of proteins. During uncomplicated (non-inflammatory) periods of cell differentiation, ELF3 is expressed exclusively by epithelial cells, repressing genes needed during early differentiation, and promoting genes needed for full differentiation. Under conditions of inflammation, cells such as monocytes, endothelial cells and chrondrocytes express ELF3 and produce molecules such as Ang1 and COX2. Human ELF3 is 371aa in length. It contains one PNT/pointed dimerization domain aa46-132, a protein stabilizing PEST sequence aa210-225, an A/T Hook region that binds to AT-rich DNA sequences aa236-252, and an ETS DNA binding domain aa273-355. ELF3 interacts with CREBBP, EP300, KU70 and KU86. There is one splice variant that shows a deletion of aa174-200. Over aa1-173, human ELF3 shares 87aa identity with mouse ELF3. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EGKKSKHAPRGTHLWEFIRDILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNSSGWKEEEVLQSRN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice