EIF5A (Eukaryotic Translation Initiation Factor 5A-1, eIF-5A-1, eIF-5A1, Eukaryotic Initiation Factor 5A Isoform 1, eIF-5A, eIF-4D, Rev-binding Factor)

Größe

£685.00

SKU:: 126256
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa66-154 from human EIF5A2 (NP_065123) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1E7
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: EIF5A precursor is the only cellular protein known to contain a specific lysine residue which is transformed into the unique amino acid hypusine [N-(4-amino-2-hydroxybutyl)-lysine] by a series of post translational reactions. eIF5A promotes the formation of the first peptide bond during the initial stage of protein synthesis. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.