EIF4ENIF1 (Eukaryotic Translation Initiation Factor 4E Transporter, 4E-T, eIF4E Transporter, Eukaryotic Translation Initiation Factor 4E Nuclear Import Factor 1, 2610509L04Rik, FLJ21601, FLJ26551)

Größe

£685.00

SKU:: 126245
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa886-986 from human EIF4ENIF1 (NP_062817) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2C4
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Nucleoplasmic shuttling protein. Mediates the nuclear import of EIF4E by a piggy-back mechanism. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NPRPGTPLHLAMVQQQLQRSVLHPPGSGSHAAAVSVQTTPQNVPSRSGLPHMHSQLEHRPSQRSSSPVGLAKWFGSDVLQQPLPSMPAKVISVDELEYRQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.