126245-APC

EIF4ENIF1 (Eukaryotic Translation Initiation Factor 4E Transporter, 4E-T, eIF4E Transporter, Eukaryotic Translation Initiation Factor 4E Nuclear Import Factor 1, 2610509L04Rik, FLJ21601, FLJ26551) (APC)

Größe

£927.00

SKU:: 126245-APC
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa886-986 from human EIF4ENIF1 (NP_062817) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2C4
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Weitere Details:: Nucleoplasmic shuttling protein. Mediates the nuclear import of EIF4E by a piggy-back mechanism. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NPRPGTPLHLAMVQQQLQRSVLHPPGSGSHAAAVSVQTTPQNVPSRSGLPHMHSQLEHRPSQRSSSPVGLAKWFGSDVLQQPLPSMPAKVISVDELEYRQ Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.