126240
EIF4EBP1 (Eukaryotic Translation Initiation Factor 4E-binding Protein 1, 4E-BP1, eIF4E-binding Protein 1, Phosphorylated Heat- and Acid-stable Protein Regulated by Insulin 1, PHAS-I)
Größe
£685.00
- SKU:
- 126240
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-118 from human EIF4EBP1 (AAH04459) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4F3-H2
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- EIF4EBP1 is one member of a family of translation repressor proteins. It directly interacts with eukaryotic translation initiation factor 4E (eIF4E), which is a limiting component of the multisubunit complex that recruits 40S ribosomal subunits to the 5' end of mRNAs. Interaction of this protein with eIF4E inhibits complex assembly and represses translation. This protein is phosphorylated in response to various signals including UV irradiation and insulin signaling, resulting in its dissociation from eIF4E and activation of mRNA translation. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice