EIF3S1 (Eukaryotic Translation Initiation Factor 3 Subunit J, Eukaryotic Translation Initiation Factor 3 Subunit 1, eIF-3-alpha, eIF3 p35, eIF3j, EIF3J, PRO0391)

Größe

£685.00

SKU:: 126235
Anwendung:: WB
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length human EIF3S1, aa1-258 (NP_003749.2).
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: EIF3S2 is the largest of the EIFs. It consists of at least 10 nonidentical subunits in mammals. In S. cerevisiae the p39 subunit contains WD repeats; these are thought to mediate protein-protein interactions. The p39 protein appears to be essential for maintaining the integrity of the yeast EIF3 complex. The mammalian EIF3-p36 subunit is homologous to yeast p39. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAAAAAAAGDSDSWDADAFSVEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDEKKEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRLKKLQEESDLELAKETFGVNNAVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEVLVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDYEDFM Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.