126216-BIOTIN
EHMT1 (Histone H3-K9 Methyltransferase 5, H3-K9-HMTase 5, Euchromatic Histone-lysine N-methyltransferase 1, Eu-HMTase1, G9a-like Protein 1, GLP1, Lysine N-methyltransferase 1D, EHMT1, EUHMTASE1, KIAA1876, KMT1D, bA188C12.1, DEL9q34, DKFZp667M072, FLJ12879, FP13812) (Biotin)
Größe
£914.00
- SKU:
- 126216-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1-101 from human EHMT1 (NP_079033) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3G1
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- EHMT1, also known as EUHMTASE1, is a histone methyltransferase. This protein methylates 'Lys-9' of histone H3 in vitro. H3 'Lys-9' methylation represents a specific tag for epigenetic transcriptional repression by recruiting HP1 proteins to methylated histones. EHMT1 is Probably targeted to histone H3 by different DNA-binding proteins like E2F6, MGA, MAX and/or DP1. During G0 phase, it probably contributes to silencing of MYC- and E2F-responsive genes, suggesting a role in the G0/G1 transition of the cell cycle. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MAADEGSAEKQAGEAHMAADGETNGSCENSDASSHANAAKHTQDSARVNPQDGTNTLTRIAENGVSERDSEAAKQNHVTADDFVQTSVIGSNGYILNKPA Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice