EEF1B2 (Elongation Factor 1-beta, EF-1-beta, EEF1B, EF1B)

Größe

£685.00

SKU:: 126167
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa29-91 from human EEF1B2 (NP_001950.1) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3A5
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: EF-1-beta and EF-1-delta stimulate the exchange of GDP bound to EF-1-alpha to GTP. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.