E2F1 (Transcription Factor E2F1, E2F-1, PBR3, PRB-binding Protein E2F-1, RBBP-3, Retinoblastoma-associated Protein 1, RBAP-1, Retinoblastoma-binding Protein 3, RBBP3)

Größe

£685.00

SKU:: 126111
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa348-437 from human E2F1 (NP_005216.1) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2E10
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: The E2F family of transcription factors appears to play a critical role in the transcription of certain genes required for cell cycle progression. E2F1, the first cloned member of this family, is regulated during the cell cycle at the mRNA level by changes in transcription of the E2F1 gene and at the protein level by complex formation with proteins such as the retinoblastoma gene product (pRB), cyclin A and DP1. It binds to variants of the consensus sequence TTTCGCGC, found in the promoters of a number of genes important for cell cycle progression, including c-myc, cdc2, cdc6, dihydrofolate reductase, thymidine kinase, and the E2F-1 gene itself. It plays an important role in both cell cycle regulation and apoptosis. It promotes entry into S phase and stimulates cell cycle progression. It function is regulated by the retinoblastoma protein, which binds to the transactivation domain of E2F-1 and suppresses E2F-1-mediated transcriptional activation. It exhibits dual function, can stimulate cell cycle progression as an oncogene, or can promote p53-dependent apoptosis and suppress tumorigenesis as a tumor suppressor gene. Fluorescence in situ hybridization localized E2F1 to chromosome 20q11. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QSLLSLEQEPLLSRMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEGIRDLFDCDFGDLTPLDF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice