126098-FITC
DYRK1B (Dual Specificity Tyrosine-phosphorylation-regulated Kinase 1B, Minibrain-related Kinase, Mirk Protein Kinase, MIRK) (FITC)
Größe
£914.00
- SKU:
- 126098-FITC
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa479-569 from DYRK1B (AAH25291) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2E8
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Weitere Details:
- DYRK1B is a member of the DYRK/minibrain family of dual specificity tyrosine-regulated, arginine-directed protein kinases. It is a serine/threonine protein kinase which is expressed at elevated levels in normal skeletal muscle and certain carcinoma cell lines. It contains all motifs characteristic for the DYRK family of protein kinases. In addition, the protein also comprises a bipartite nuclear localization motif. The protein functions as a transactivator of a different transcription factor, HNF1a, to which it binds through the dimerization co-factor DcoH of HNF1a. Human DYRK1B gene is mapped to chromosome 19 (19q12-13.11). Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DNRTYRYSNRYCGGPGPPITDCEMNSPQVPPSQPLRPWAGGDVPHKTHQAPASASSLPGTGAQLPPQPRYLGRPPSPTSPPPPELMDVSLV Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice