126093-BIOTIN
DYNLL1 (Dynein Light Chain 1, Cytoplasmic, 8kD Dynein Light Chain, DLC8, Dynein Light Chain LC8-type 1, Protein Inhibitor of Neuronal Nitric Oxide Synthase, PIN, DLC1, DNCL1, DNCLC1, HDLC1, MGC126137, MGC126138) (Biotin)
Größe
£914.00
- SKU:
- 126093-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1-73 from DYNLL1 (NP_003737) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1H7
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- DYNLL1, also known as DLC8 or PIN (protein inhibitor of neuronal nitric oxide synthase), has been identified as a protein that interacts with NOS1 resulting in NOS1 inhibition. Binding of this protein destabilizes NOS1(Neuronal nitric oxide synthase) dimer, a conformation necessary for activity, and it may regulate numerous biologic processes through its effects on nitric oxide synthase activity. DYNLL1 is a ubiquitously expressed protein that exhibits high expression in testis and moderate expression in brain. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequece: MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKH* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice