126093-APC
DYNLL1 (Dynein Light Chain 1, Cytoplasmic, 8kD Dynein Light Chain, DLC8, Dynein Light Chain LC8-type 1, Protein Inhibitor of Neuronal Nitric Oxide Synthase, PIN, DLC1, DNCL1, DNCLC1, HDLC1, MGC126137, MGC126138) (APC)
Größe
£927.00
- SKU:
- 126093-APC
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1-73 from DYNLL1 (NP_003737) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1H7
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Weitere Details:
- DYNLL1, also known as DLC8 or PIN (protein inhibitor of neuronal nitric oxide synthase), has been identified as a protein that interacts with NOS1 resulting in NOS1 inhibition. Binding of this protein destabilizes NOS1(Neuronal nitric oxide synthase) dimer, a conformation necessary for activity, and it may regulate numerous biologic processes through its effects on nitric oxide synthase activity. DYNLL1 is a ubiquitously expressed protein that exhibits high expression in testis and moderate expression in brain. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequece: MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKH* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice