DUSP16 ((Dual Specificity Protein Phosphatase 16, KIAA1700, Mitogen-activated Protein Kinase Phosphatase 7, MAP Kinase Phosphatase 7, MKP7, MKP-7, MGC129701, MGC129702)

Größe

£685.00

SKU:: 126059
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa561-666 from human DUSP16 (NP_085143) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3F3
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: DUSP16 is involved in the inactivation of MAP kinases. The activation of mitogen-activated protein kinase (MAPK) cascades transduces various extracellular signals to the nucleus to induce gene expression, cell proliferation, differentiation, cell cycle arrest, and apoptosis. For full activation of MAPKs, dual-specificity kinases phosphorylate both threonine and tyrosine residues in MAPK TXY motifs. MKPs are dual-specificity phosphatases that dephosphorylate the TXY motif, thereby negatively regulating MAPK activity. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TESSHFYSASAIYGGSASYSAYSCSQLPTCGDQVYSVRRRQKPSDRADSRRSWHEESPFEKQFKRRSCQMEFGESIMSENRSREELGKVGSQSSFSGSMEIIEVS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.