126057-BIOTIN
DUSP14 (Dual Specificity Protein Phosphatase 14, Mitogen-activated Protein Kinase Phosphatase 6, MAP Kinase Phosphatase 6, MKP6, MKP-6, MKP-1-like Protein Tyrosine Phosphatase, MKP-L) (Biotin)
Größe
£914.00
- SKU:
- 126057-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-199 from human DUSP14 (AAH00370) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4B5-E6
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- DUSP14 is involved in the inactivation of MAP kinases. This proein dephosphorylates ERK, JNK and p38 MAP-kinases. In addition to antigen recognition by the T-cell receptor, T-cell activation requires a second signal from a costimulatory receptor, such as CD28, which interacts with B7-1 (CD80) and B7-2 (CD86) ligands on antigen-presenting cells. CD28 costimulation induces transcription of interleukin-2 and stabilizes newly synthesized IL2 through the activation of mitogen-activated protein kinases (MAPKs), such as ERK and JNK, and the subsequent creation of AP1 transcription factor. DUSP14 is a negative regulator of CD28 signaling. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGI Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice