126043
DTX3 (RNF154, Probable E3 Ubiquitin-protein Ligase DTX3, Protein Deltex-3, RING Finger Protein 154, FLJ34766, MGC138863, MGC138864)
Größe
£685.00
- SKU:
- 126043
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa201-301 from human DTX3 (NP_848597) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4F10
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- DTX3 functions as an E3 ubiquitin ligase (Takeyama et al., 2003 [PubMed 12670957]). Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MCGRFYGQLVGNQPQNGRMLVSKDATLLLPSYEKYGTIVIQYVFPPGVQGAEHPNPGVRYPGTTRVAYLPDCPEGNKVLTLFRKAFDQRLTFTIGTSMTT Storage and Stability: May be stored at 4°C. For long-term storage, aliquot and store at 4°C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer.
- Versandbedingungen:
- Blue Ice