DR5 (Death Receptor 5, CD262, HGNC:11905, KILLER, TNF-related Apoptosis-inducing Ligand Receptor 2, TRAIL Receptor 2, TRAILR2, TRAIL-R2, TRICK2, TRICK2A, TRICK2B, TRICKB, Tumor Necrosis Factor Receptor Superfamily Member 10B, TNFRSF10B, UNQ160/PRO186, ZTNFR9)

Größe

£685.00

SKU:: 126017
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa71-170 from TNFRSF10B (AAH01281) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2D6
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: A subset of the tumor necrosis factor (TNF) receptor family contain a conserved intracellular motif, the death domain. A member of this family, TRICK2, the TRAIL (TNF-related apoptosis-inducing ligand) receptor inducer of cell killing 2) is expressed in a number of cell types, and to particularly high levels in lymphocytes and spleen. TRICK2, like DR4, is a receptor for TRAIL:APO-2L [2,3] and could inhibit TRAIL-induced killing. Applications: Suitable for use in ELISA, Immunoprecipitation and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDC Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.