126017-FITC

DR5 (Death Receptor 5, CD262, HGNC:11905, KILLER, TNF-related Apoptosis-inducing Ligand Receptor 2, TRAIL Receptor 2, TRAILR2, TRAIL-R2, TRICK2, TRICK2A, TRICK2B, TRICKB, Tumor Necrosis Factor Receptor Superfamily Member 10B, TNFRSF10B, UNQ160/PRO186, ZTNFR9) (FITC)

Größe

£914.00

SKU:: 126017-FITC
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa71-170 from TNFRSF10B (AAH01281) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2D6
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Weitere Details:: A subset of the tumor necrosis factor (TNF) receptor family contain a conserved intracellular motif, the death domain. A member of this family, TRICK2, the TRAIL (TNF-related apoptosis-inducing ligand) receptor inducer of cell killing 2) is expressed in a number of cell types, and to particularly high levels in lymphocytes and spleen. TRICK2, like DR4, is a receptor for TRAIL:APO-2L [2,3] and could inhibit TRAIL-induced killing. Applications: Suitable for use in FLISA, Immunoprecipitation and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDC Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Versandbedingungen:: Blue Ice