126010-ML550
DPYSL5 (Dihydropyrimidinase-related Protein 5, DRP-5, CRMP3-associated Molecule, CRAM, Collapsin Response Mediator Protein 5, CRMP-5, UNC33-like Phosphoprotein 6, ULIP-6, CRMP5, ULIP6) (MaxLight 550)
Größe
£914.00
- SKU:
- 126010-ML550
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa466-565 from human DPYSL5 (NP_064519) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2G4
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
- Weitere Details:
- MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000. The collapsin response mediator protein (CRMP) family of proteins (also referred to as ULIP6) are a group of neurologic proteins that have been found to play key roles in growth cone guidance during neural development. CRMP5 has relatively low sequence homology with the other four members of the CRMP family. CRMP5 is expressed in the developing nervous system in an expression pattern that resembles CRMP2 and has a peak expression during the first postnatal week. Elevated levels of autoantibody to CRMP5 have been shown to be linked paraneoplastic autoimmune optic neuritis and other paraneoplastic neoplasms. Auto-immunity against CRMP5 expression (predominantly the N-terminal epitopes) is also being investigated as an oncological marker in the respiratory system and in the thymus. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SFPDTVYKKLVQREKTLKVRGVDRTPYLGDVAVVVHPGKKEMGTPLADTPTRPVTRHGGMRDLHESSFSLSGSQIDDHVPKRASARILAPPGGRSSGIW Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice