DPYSL2 (Dihydropyrimidinase-related Protein 2, DRP-2, Collapsin Response Mediator Protein 2, CRMP-2, N2A3, Unc-33-like Phosphoprotein 2, ULIP-2, CRMP2, ULIP2)

Größe

£685.00

SKU:: 126007
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa470-571 from human DPYSL2 (NP_001377.1) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1F11
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: CRMP2 also regulates axon formation and branching by binding tubulin heterodimers thereby enhancing microtubule polymerisation. Through its interaction with ROKalpha, CRMP2 is also thought to play a role in RhoA-dependent signalling. CRMP2 is associated with mesial temporal lobe epilepsy and schizophrenia. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVAPPGGRANITSL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.