DPP8 (Dipeptidyl Peptidase 8, DP8, Dipeptidyl Peptidase IV-related Protein 1, DPRP-1, Dipeptidyl Peptidase VIII, DPP VIII, Prolyl Dipeptidase DPP8, DPRP1, MSTP097, MSTP135, MSTP141, FLJ14920, FLJ20283, MGC26191)

Größe

£685.00

SKU:: 126001
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa161-244 from human DPP8 (NP_932065) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1B10
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Dipeptidyl peptidase that cleaves off N-terminal dipeptides from proteins having a Pro or Ala residue at position 2. May play a role in T-cell activation and immune function. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: IGTVGIASYDYHQGSGTFLFQAGSGIYHVKDGGPQGFTQQPLRPNLVETSCPNIRMDPKLCPADPDWIAFIHSNDIWISNIVTR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.