126001-BIOTIN

DPP8 (Dipeptidyl Peptidase 8, DP8, Dipeptidyl Peptidase IV-related Protein 1, DPRP-1, Dipeptidyl Peptidase VIII, DPP VIII, Prolyl Dipeptidase DPP8, DPRP1, MSTP097, MSTP135, MSTP141, FLJ14920, FLJ20283, MGC26191) (Biotin)

Größe

£914.00

SKU:: 126001-BIOTIN
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa161-245 from human DPP8 (NP_932065) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1B10
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Weitere Details:: Dipeptidyl peptidase that cleaves off N-terminal dipeptides from proteins having a Pro or Ala residue at position 2. May play a role in T-cell activation and immune function. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: IGTVGIASYDYHQGSGTFLFQAGSGIYHVKDGGPQGFTQQPLRPNLVETSCPNIRMDPKLCPADPDWIAFIHSNDIWISNIVTR Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.