DPP3 (Dipeptidyl Peptidase 3, Dipeptidyl Aminopeptidase III, Dipeptidyl Arylamidase III, Dipeptidyl Peptidase III, DPP III)

Größe

£698.00

SKU:: 125999
Reinheit:: Ascites
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa424-504 from DPP3 (NP_005691.2) with GST tag. MW of the GST tag alone is 26 KDa.
Klon:: 4D3
Format:: Supplied as a liquid in ascites fluid.
Weitere Details:: Cleaves Arg-Arg-beta-naphthylamide. Applications: Suitable for use in Western Blot and ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LTFLEEDDKDLYILWKGPSFDVQVGLHELLGHGSGKLFVQDEKGAFNFDQETVINPETGEQIQSWYRSGETWDSKFSTIAS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.