125997
DPH2 (Diphthamide Biosynthesis Protein 2, DPH2 Homolog, HsDph2, Diphthamide Biosynthesis Protein 2 Homolog-like 2, DPH2-like 2, DPH2L2)
Größe
£685.00
- SKU:
- 125997
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa125-235 from human DPH2 (NP_001375) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 5B10
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- Required for the first step in the synthesis of diphthamide, a post-translational modification of histidine which occurs in translation elongation factor 2. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: RQRSVALELCVKAFEAQNPDPKAPVVLLSEPACAHALEALATLLRPRYLDLLVSSPAFPQPVGSLSPEPMPLERFGRRFPLAPGRRLEEYGAFYVGGSKASPDPDLDPDLS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice