DOT1L (KMT4, Histone-lysine N-methyltransferase, H3 Lysine-79 Specific, Histone H3-K79 Methyltransferase, H3-K79-HMTase, DOT1-like Protein, Lysine N-methyltransferase 4, KIAA1814, DKFZp586P1823)

Größe

£685.00

SKU:: 125992
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa3-109 from human DOT1L (NP_115871) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 6A6
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Histone methyltransferase. Methylates 'Lys-79' of histone H3. Nucleosomes are preferred as substrate compared to free histones. Binds to DNA. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: EKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.