125978-BIOTIN
DNTT (DNA Nucleotidylexotransferase, Terminal Addition Enzyme, Terminal Deoxynucleotidyltransferase, Terminal Transferase, TDT) (Biotin)
Größe
£914.00
- SKU:
- 125978-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1-110 from human DNTT (AAH12920) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4H5
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- Terminal deoxynucleotidyl transferase (TdT) is a DNA polymerase that catalyses the polymerization of deoxynucleotides at the 3' hydroxyl ends of oligo or polydeoxynucleotide initiators and functions without a template. It is expressed in primitive T and B lympho- cytes of the thymus and bone marrow, and appears to have been highly activated in certain leukaemias. This antibody will help identify TdT in normal and uncharacterized tissues. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MDPPRASHLSPRKKRPRQTGALMASSPQDIKFQDLVVFILEKKMGTTRRAFLMELARRKGFRVENELSDSVTHIVAENNSGSDVLEWLQAQKVQVSSQPELLDVSWLIEC Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice