125978-APC
DNTT (DNA Nucleotidylexotransferase, Terminal Addition Enzyme, Terminal Deoxynucleotidyltransferase, Terminal Transferase, TDT) (APC)
Größe
£927.00
- SKU:
- 125978-APC
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1-110 from human DNTT (AAH12920) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4H5
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Weitere Details:
- Terminal deoxynucleotidyl transferase (TdT) is a DNA polymerase that catalyses the polymerization of deoxynucleotides at the 3' hydroxyl ends of oligo or polydeoxynucleotide initiators and functions without a template. It is expressed in primitive T and B lympho- cytes of the thymus and bone marrow, and appears to have been highly activated in certain leukaemias. This antibody will help identify TdT in normal and uncharacterized tissues. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MDPPRASHLSPRKKRPRQTGALMASSPQDIKFQDLVVFILEKKMGTTRRAFLMELARRKGFRVENELSDSVTHIVAENNSGSDVLEWLQAQKVQVSSQPELLDVSWLIEC Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice