DNER (Delta and Notch-like Epidermal Growth Factor-related Receptor, BET, UNQ262/PRO299)

Größe

£685.00

SKU:: 125964
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa368-477 from human DNER (NP_620711) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4E8
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Activator of the NOTCH1 pathway. May mediate neuron-glia interaction during astrocytogenesis. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NEKQDGSNFTCVCLPGYTGELCQSKIDYCILDPCRNGATCISSLSGFTCQCPEGYFGSACEEKVDLCASSPCQNNGTCYVDGVHFTCNCSPGFTGPTCAQLIDFCALSP Storage and Stability: May be stored at 4°C. For long-term storage, aliquot and store at 4°C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer.