125932
DNAJB2 (DnaJ Homolog Subfamily B Member 2, DnaJ Protein Homolog 1 Heat Shock 40kD Protein 3 Heat Shock Protein J1, HSJ-1, HSJ1, HSPF3)
Größe
£685.00
- SKU:
- 125932
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa216-324 from human DNAJB2 (NP_006727) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2C9
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- DnaJB2, also known as HSJ1 or HSPF3, is belongs to the DnaJ family. It is expressed almost exclusively in the brain, with the highest levels in the frontal cortex and hippocampus. The DnaJ family is one of the largest of all the chaperone families and has evolved with diverse cellular localization and functions. The DnaJ proteins play a critical role in the HSP70 chaperone machine by interacting with HSP70 to stimulate ATP hydrolysis. DnaJB2 is important mediators of proteolysis and are involved in the regulation of protein degradation, exocytosis and endocytosis. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: LELSRREQQPSVTSRSGGTQVQQTPASCPLDSDLSEDEDLQLAMAYSLSEMEAAGKKPAGGREAQHRRQGRPKAQHQDPGLGGTQEGARGEATKRSPSPEEKASRCLIL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice