DIO-1 (Death-inducer Obliterator 1, hDido1, Death-associated Transcription Factor 1, DATF-1, DIDO1, C20orf158, DATF1, KIAA0333)

Größe

£685.00

SKU:: 125849
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa321-420 from human DIDO1 (AAH14489) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3B1
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Apoptosis plays an important role in many cellular processes. Dio-1 (Death Inducer-O bliterator-1), a putative transcription factor, has been indicated to function in the onset of apoptosis. Dio-1 expression is upregulated when an apoptosis is detected. It translocates to the nucleus, and activates apoptosis during limb development. Dio-1 expression can be suppressed by caspase inhibitors and Bcl-2 expression. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ILQVQDETHSETADQQEAKWRPGDADGTDCTSIGTIEQKSSEDQGIKGRIEKAANPSGKKKLKIFQPVIEAPGASKCIGPGCCHVAQPDSVYCSNDCILK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.