125849-HRP
DIO-1 (Death-inducer Obliterator 1, hDido1, Death-associated Transcription Factor 1, DATF-1, DIDO1, C20orf158, DATF1, KIAA0333) (HRP)
Größe
£914.00
- SKU:
- 125849-HRP
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa321-420 from human DIDO1 (AAH14489) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3B1
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
- Weitere Details:
- Apoptosis plays an important role in many cellular processes. Dio-1 (Death Inducer-O bliterator-1), a putative transcription factor, has been indicated to function in the onset of apoptosis. Dio-1 expression is upregulated when an apoptosis is detected. It translocates to the nucleus, and activates apoptosis during limb development. Dio-1 expression can be suppressed by caspase inhibitors and Bcl-2 expression. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ILQVQDETHSETADQQEAKWRPGDADGTDCTSIGTIEQKSSEDQGIKGRIEKAANPSGKKKLKIFQPVIEAPGASKCIGPGCCHVAQPDSVYCSNDCILK Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice