DHODH (Dihydroorotate Dehydrogenase (Quinone), Mitochondrial, DHOdehase, Dihydroorotate Oxidase)

Größe

£685.00

SKU:: 125818
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa32-140 from human DHODH (NP_001352) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 6E1
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilutions: Sandwich ELISA: The detection limit is ~0.3ng/ml as a capture antibody Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: GDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.