DGAT2 (Diacylglycerol O-acyltransferase 2, Acyl-CoA Retinol O-fatty-acyltransferase, ARAT, Retinol O-fatty-acyltransferase, Diglyceride Acyltransferase 2, HMFN1045, UNQ738/PRO1433, DKFZp686A15125)

Größe

£685.00

SKU:: 125789
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa289-389 from human DGAT2 (NP_115953) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4C1
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Essential acyltransferase that catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. Required for synthesis and storage of intracellular triglycerides. Probably plays a central role in cytosolic lipid accumulation. In liver, is primarily responsible for incorporating endogenously synthesized fatty acids into triglycerides. Functions also as an acyl-CoA retinol acyltransferase (ARAT). Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: IFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHTMYMEALVKLFDKHKTKFGLPETEVLEVN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.