DFNA5 (Non-syndromic Hearing Impairment Protein 5, Inversely Correlated With Estrogen Receptor Expression 1, ICERE-1, ICERE1)

Größe

£685.00

SKU:: 125787
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa111-200 from human DFNA5 (NP_004394) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1E10
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Hearing impairment is a heterogeneous condition with over 40 loci described. DFNA5 is expressed in fetal cochlea, however, its function is not known. Applications: Suitable for use in Western Blot and ELISA. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit is ~3ng/ml as a capture antibody. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: SQSSFGTLRKQEVDLQQLIRDSAERTINLRNPVLQQVLEGRNEVLCVLTQKITTMQKCVISEHMQVEEKCGGIVGIQTKTVQVSATEDGN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.